Cyhr1

Author: pymk

August undefined, 2024

WebCYHR1 CRISPR Knockout and Activation Plasmids (m) designed to edit, knockdown or upregulate mouse CYHR1 gene expression. Choose a Store Santa cruz biotechnology. Santa Cruz Animal Health. Choose a Language English Français 日本語中文 한글 ... WebMeaning. CVHR. Cyclic Variation of Heart Rate (cardiology) CVHR. Citizens' Voice for Health Rights (Canada) CVHR. Cardiovasculaire, Hémostase, Respiration (French: …

Pre-made anti-CYHR1 monoclonal antibody(mab)-benchmark …

WebCYHR1, KIAA0496. Organism names. Organism. Homo sapiens (Human) Taxonomic identifier. 9606 NCBI. Taxonomic lineage. Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo. Accessions. Primary accession. P0DTL6. … WebPrEST Antigen CYHR1; Blocking agent and positive assay control using corresponding antibodies. Bulk and Prepack available at Sigmaaldrich.com. US EN. Applications Products Services Support. APREST89884; All Photos (1) APREST89884. PrEST Antigen CYHR1. how to stop tracking on your computer

CYHR1 Polyclonal Antibody (PA5-66263) - thermofisher.com

Webanti-CYHR1 antibody (Cysteine/histidine-Rich 1) AA 51-100. anti-CYHR1 antibody (Cysteine/histidine-Rich 1) Middle Region. Browse Primary Antibodies and Browse … WebCYHR1. 1110031M01Rik, AU042374, Chrp. cysteine and histidine rich 1. GO Process (0) GO Function (1) GO Component (3) Gene Ontology Molecular Function. protein binding . Gene Ontology Cellular Component. cytoplasm ; nuclear envelope ; nucleoplasm . WebJul 1, 2004 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1 gene ... how to stop tracking cookies windows 10

Cyhr1

WebMar 21, 2024 · GeneHancers around lnc-CYHR1-1 on the GeneHancer Hub at the UCSC Golden Path Genomic Locations for lnc-CYHR1-1 Gene Latest Assembly … WebInvitrogen Anti-CYHR1 Polyclonal, Catalog # PA5-62823. Tested in Immunocytochemistry (ICC/IF) and Immunohistochemistry (Paraffin) (IHC (P)) applications. This antibody reacts with Human samples. Supplied as 100 µL purified antibody (0.05 mg/mL).

Did you know?

WebCyhr1 cysteine and histidine rich 1 [ (house mouse)] Gene ID: 54151, updated on 8-Nov-2024 Summary Predicted to enable zinc ion binding activity. Located in cytoplasm and … WebThe estimate of $40 million for the total cost of this program is based on an assumed 100 researchers leading 400 short courses for 6,000 other individuals.(12) These funds …

WebCYHR1 (HGNC Symbol) Synonyms: CHRP, KIAA0496, MGC13010: Description: Cysteine and histidine rich 1 (HGNC Symbol) Entrez gene summary: Chromosome: 8: Cytoband: …

WebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% … WebHigh CYHR1 expression is associated with Esophageal Squamous Cell Carcinoma. ...

WebPrEST Antigen CYHR1 [Catalog No.: ATL-APrEST76449] Toggle menu. Compare ; Phone: 760-431-4600 / Fax: 760-431-4604; Sign in or Register; Cart 0. Search. CURRENT …

WebCYHR1 in human cancer is unknown.16–19 To evaluate the role and signiﬁcance of CYHR1 in ESCC, we established CYHR1 knock-out esophageal cancer cells by using the small interfering RNA (siRNA) transfection method. Then, we performed a functional analysis, used reverse tran-scription-polymerase chain reaction (RT-PCR) to detect the how to stop tracking on iphoneWebMar 1, 2011 · This CYHR1 fragment is almost as good a predictor of good response (receiver operating characteristic=0.91) as OSMR is a predictor of poor response (receiver operating characteristic=0.98). The current state of knowledge on CYHR1 is limited regarding its predicted protein structure, protein–protein interactions, subcellular … how to stop tracking on pcWebCYHR1 Antibody. Applications: ICC/IF, WB, IHC. Reactivity: Human, Mouse. Images: 5. Clonality: Polyclonal. Conjugates: Unconjugated. how to stop tracking my iphonePROTEIN SUMMARY SECTION OVERVIEW RNA DATA ANTIBODY DATA. CYHR1 INFORMATION. Proteini. Full gene name according to HGNC. Cysteine and histidine rich 1. Gene namei. Official gene symbol, which is typically a short form of the gene name, according to HGNC. CYHR1 (CHRP, KIAA0496, MGC13010) Protein classi. read protectionWebIt's the GeneMedi's summary page for Target/Biomarker Introduction of CYHR1. The page also collects GeneMedi's different modalities and formats products for CYHR1 in therapeutics/drug discovery and IVD diagnostics, which is including antibody, ADC, bispecific, antigen, ORF vector, VLP, etc. With GeneMedi's target-insight database-GM … how to stop tracking on life360WebMar 21, 2024 · lnc-CYHR1-1 is an RNA Gene, and is affiliated with the lncRNA class. Additional gene information for lnc-CYHR1-1 Gene Search for lnc-CYHR1-1 at DataMed Search for lnc-CYHR1-1 at HumanCyc read psalm ninety oneWebThe deduced 311-amino acid protein has an N-terminal cysteine- and histidine-rich domain that shares similarity with metal-binding zinc finger domains in other proteins. Northern … read psycho revenge